Maybe you were looking for...

Why can templates only be implemented in the header file?

Quote from The C++ standard library: a tutorial and handbook: The only portable way of using templates at the moment is to implement them in header files by

In JavaScript, can I prevent the onmouseup event from being triggered, replacing it with my own event?

I'm creating a slider widget to let me manage ranges of values, and have most of it complete. Here is a demo of it: https://jsfiddle.net/d1wqb63a/ I want to set

Use loop to render three column image gallery with no set number of images

I am outputting images from a gallery created with WordPress and Advanced Custom Fields. The following code is displaying two images per column, with the column

Insert a newline character every 10 characters in a string using Julia

I want to insert a newline character every 10 characters in a protein sequence : seq="MSKNKSPLLNESEKMMSEMLPMKVSQSKLNYEEKVYIPTTIRNRKQHCFRRFFPYIALFQ" In Perl,

How to Cross-Compile from LLVM IR to Assembly for ARM Cortex M4?

I'm trying to cross-compile an llvm-ir file to assembly, or better generate an object file, for an ARM Cortex M4 microprocessor using llc compiler. Which are th

Get employee data from imported Excel file based on the work phone of employee odoo 13

I have a custom module and I have created a model and its view. I have an excel sheet that contains employees' work phones. I want when I import this excel shee

Indenting OCaml code in visual studio code

There are several questions here on indenting code in visual studio code (How do you format code in Visual Studio Code (VSCode)?), and on indenting OCaml code (

How to get from a list of a Monad to a Monad of a list

I am looking for a way to convert a type of [m [a]] to m [[a]] where m is a Monad of some type.